PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039743
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 242aa    MW: 27156.6 Da    PI: 10.4099
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039743genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l   ++++G+g+W+t ++  g+ R++k+c++rw +yl
      Lus10039743 14 KGPWTTEEDQKLTSFIQLHGPGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.31.5e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Lus10039743  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.51961IPR017930Myb domain
SuperFamilySSF466899.36E-3111108IPR009057Homeodomain-like
SMARTSM007173.0E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.01E-111661No hitNo description
PROSITE profilePS5129425.09662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-2665116IPR009057Homeodomain-like
SMARTSM007174.0E-1666114IPR001005SANT/Myb domain
PfamPF002496.5E-1667111IPR001005SANT/Myb domain
CDDcd001673.10E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRTPCCDKN GLKKGPWTTE EDQKLTSFIQ LHGPGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIRRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRNG  120
IDPVTHAPRL DVLDLSAILG SALCHVTPAA SLLSLLAGAG QAQQQQLFNP ELLRLAAALG  180
SLNQQQXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXTAAG  240
A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-29121162105MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-291211656159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-291211656159MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-291211625128MYB TRANSFORMING PROTEIN
1mse_C1e-29121162105C-Myb DNA-Binding Domain
1msf_C1e-29121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447404.11e-107hypothetical protein CICLE_v10017668mg
RefseqXP_006469819.11e-107PREDICTED: transcription factor MYB35
SwissprotQ8GWP01e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLV4W3V41e-107V4W3V4_9R
STRINGPOPTR_0019s14070.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.13e-97MYB-like 102